PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG039448t2
Common NameTCM_039448
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HB-PHD
Protein Properties Length: 753aa    MW: 84739.1 Da    PI: 9.9735
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG039448t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox33.19.5e-11527571953
                       HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
          Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                       ++ +e L ++F++n  ps+  +e L+k+lgL+ ++V  WF+N R+
  Thecc1EG039448t2 527 PTAVEKLRQVFAENELPSRVIKENLSKELGLEPEKVNKWFKNARY 571
                       67899**************************************97 PP

2PHD34.83.7e-12262317151
                       SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
               PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                       +C+ C+   +  ++++vlCd +C+ +fH+kCl+++l++e++p g   w+C+ C++k
  Thecc1EG039448t2 262 FCAKCKLheAFPDNDIVLCDgTCNCAFHQKCLDPPLDTENIPPGeqGWFCKFCDCK 317
                       699999854445********56********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579033.99E-13254320IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.106.5E-11258317IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.14260317IPR019787Zinc finger, PHD-finger
SMARTSM002492.8E-7262315IPR001965Zinc finger, PHD-type
PfamPF006282.2E-9262317IPR019787Zinc finger, PHD-finger
CDDcd155042.88E-31262314No hitNo description
PROSITE patternPS013590263314IPR019786Zinc finger, PHD-type, conserved site
SuperFamilySSF466895.13E-11511571IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-13512570IPR009057Homeodomain-like
PROSITE profilePS5007112.536516576IPR001356Homeobox domain
SMARTSM003892.8E-11518580IPR001356Homeobox domain
CDDcd000863.78E-9519580No hitNo description
PfamPF000463.0E-8527571IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 753 aa     Download sequence    Send to blast
MPPLPLYAEQ RTVATSFSFD TAEISMRGTG KKVVDHESAK SSSSKKEAGS KLIATLQFKK  60
RSKISHGRVR KPKYHVKKVG SALLKTKVNA SISKGTGNDV SSSKKVGTKT NLHKANKKGS  120
SKKLDSCKLQ GKNAASGSSE ENSKKANEDV RIKNLTKKKK KRQKDKVELD EASRLQRRTR  180
YLLIKMKLEQ NLIDAYSGEG WKGQSREKIK PEKELQRAKK QILKCKLGIR EAIRQLDSLS  240
SVGSIEGSVI APDGSVYHEH IFCAKCKLHE AFPDNDIVLC DGTCNCAFHQ KCLDPPLDTE  300
NIPPGEQGWF CKFCDCKMEI IEAMNAHIGT HFSVDSHWQD IFKDEAAFPD GVIASLNPEE  360
EWPSDDSEDD DYDPERRENS CGISGAALDG DDTDDTDSST SLSWSVDGED FSGSGRRENH  420
SVDSGADSYE TSDGEIISGR RRRRAVDYKK LYDEMFGKDA PSYEQVSEDE DWGPGKRKRR  480
EKESDAASTL MTLYESETKY PNVETTEMRG QLPSDPKSRR PIFRIPPTAV EKLRQVFAEN  540
ELPSRVIKEN LSKELGLEPE KVNKWFKNAR YLALKSRKVE RADHLQSSSP GVSKESELEA  600
SKRKDPNIPQ LEDTSKKTLL HTPKRLKKKV RKSPNSKSLH SSLRRSAQNG LSLVSPANSN  660
KVRKELSDDV ILKKLLKGKK KREKKRVNIT VGGGLQQFEL EMERLCRVKV RLENMRQTLL  720
RLETSKARKL NKNRLQEESV IYIPIAEVKQ KV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1476481RKRREK
2623631KRLKKKVRK
3624630RLKKKVR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007014417.10.0Pathogenesis related homeodomain protein A, putative isoform 2
SwissprotP487851e-172PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLA0A061GR900.0A0A061GR90_THECC; Pathogenesis related homeodomain protein A, putative isoform 2
STRINGVIT_11s0103g00650.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86992738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.21e-164pathogenesis related homeodomain protein A
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]